teriparatide
SMILES | None |
InChIKey | OGBMKVWORPGQRR-UMXFMPSGSA-N |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Surrogate |
Approved drug | Yes |
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
PTH1 | PTH1R | Human | Parathyroid hormone | B1 | pIC50 | 10.1 | 10.1 | 10.1 | ChEMBL |
PTH1 | PTH1R | Human | Parathyroid hormone | B1 | pEC50 | 8.6 | 9.04 | 9.52 | ChEMBL |
PTH1 | PTH1R | Human | Parathyroid hormone | B1 | pIC50 | 8.13 | 8.13 | 8.13 | Drug Central |
PTH1 | PTH1R | Human | Parathyroid hormone | B1 | pIC50 | 7.4 | 7.4 | 7.4 | Guide to Pharmacology |
PTH2 | PTH2R | Human | Parathyroid hormone | B1 | pIC50 | 8.11 | 8.11 | 8.11 | Drug Central |
PTH2 | PTH2R | Human | Parathyroid hormone | B1 | pIC50 | 7.7 | 7.75 | 7.8 | Guide to Pharmacology |
PTH1 | PTH1R | Rat | Parathyroid hormone | B1 | pIC50 | 8.06 | 8.06 | 8.06 | Drug Central |
PTH1 | PTH1R | Rat | Parathyroid hormone | B1 | pIC50 | 8.1 | 8.4 | 8.7 | Guide to Pharmacology |
PTH2 | PTH2R | Rat | Parathyroid hormone | B1 | pIC50 | 8.2 | 8.2 | 8.2 | Drug Central |
PTH2 | PTH2R | Rat | Parathyroid hormone | B1 | pIC50 | 6.3 | 6.3 | 6.3 | Guide to Pharmacology |